DGKA Rabbit Polyclonal Antibody

SKU TA337619

Rabbit Polyclonal Anti-DGKA Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DGKA antibody: synthetic peptide directed towards the N terminal of human DGKA. Synthetic peptide located within the following region: EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 83 kDa
• Gene Name: diacylglycerol kinase alpha
• Database Link:
  NP_963848
  P23743
• Background: The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important rol
• Synonyms: DAGK; DAGK1; DGK-alpha
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 85%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system