FAM101A (RFLNA) Rabbit Polyclonal Antibody

SKU TA337588

Rabbit Polyclonal Anti-FAM101A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM101A antibody: synthetic peptide directed towards the middle region of human FAM101A. Synthetic peptide located within the following region: QLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 24 kDa
• Gene Name: family with sequence similarity 101 member A
• Database Link:
  NP_859060
  Q6ZTI6
• Background: FAM101A belongs to the FAM101 family. The exact function of FAM101A remains unknown.
• Synonyms: CFM2; FAM101A
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 86%; Rat: 86%; Mouse: 86%; Horse: 85%; Guinea pig: 85%; Zebrafish: 77%

Reference Data