NHEDC2 (SLC9B2) Rabbit Polyclonal Antibody

SKU TA337581

Rabbit Polyclonal Anti-SLC9B2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC9B2 antibody: synthetic peptide directed towards the C terminal of human SLC9B2. Synthetic peptide located within the following region: IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: solute carrier family 9 member B2
• Database Link:
  NP_849155
  Q86UD5
• Background: Sodium hydrogen antiporters, such as SLC9B2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell responses, or function in drug efflux.Sodium hydrogen antiporters, such as SLC9B2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell responses, or function in drug efflux (Xiang et al., 2007 [PubMed 18000046]). [supplied by OMIM]
• Synonyms: NHA2; NHE10; NHEDC2
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 83%

Reference Data

• Protein Families: Druggable Genome, Transmembrane