EXOC8 Rabbit Polyclonal Antibody

SKU TA337558

Rabbit Polyclonal Anti-EXOC8 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EXOC8 antibody: synthetic peptide directed towards the N terminal of human EXOC8. Synthetic peptide located within the following region: MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 82 kDa
• Gene Name: exocyst complex component 8
• Database Link:
  NP_787072
  Q8IYI6
• Background: EXOC8 is the component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane.
• Synonyms: EXO84; Exo84p; SEC84
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data