KLB Rabbit Polyclonal Antibody

SKU TA337557

Rabbit Polyclonal Anti-KLB Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLB antibody: synthetic peptide directed towards the middle region of human KLB. Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 120 kDa
• Gene Name: klotho beta
• Database Link:
  NP_783864
  Q86Z14
• Background: KLB is a single-pass type III membrane protein. It contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably inactive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.
• Synonyms: BKL
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 86%; Guinea pig: 85%

Reference Data

• Protein Families: Transmembrane