MAGEB10 Rabbit Polyclonal Antibody

SKU TA337424

Rabbit Polyclonal Anti-MAGEB10 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MAGEB10 antibody is: synthetic peptide directed towards the N-terminal region of Human MAGEB10. Synthetic peptide located within the following region: MPRGQKSKLRAREKRRQARGGLEDLIDALDILEEEEESPPSASACLKDVF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: MAGE family member B10
• Database Link:
  NP_872312
  Q96LZ2
• Background: This gene encodes a member of the B subfamily of the melanoma associated antigen protein family. The encoded protein is specifically expressed in testis and tumor cells.
• Synonyms: FLJ32965; MGC120394
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data