Leiomodin 3 (LMOD3) Rabbit Polyclonal Antibody

SKU TA337413

Rabbit Polyclonal Anti-LMOD3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LMOD3 antibody is: synthetic peptide directed towards the N-terminal region of Human LMOD3. Synthetic peptide located within the following region: VKSEEKTQEEHEEIEKRNKNMAQYLKEKLNNEIVANKRESKGSSNIQETD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: leiomodin 3
• Database Link:
  NP_938012
  Q0VAK6
• Background: The function of this protein remains unknown.
• Synonyms: NEM10
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 79%; Dog: 77%; Bovine: 77%

Reference Data