KRT78 Rabbit Polyclonal Antibody

SKU
TA337400
Rabbit Polyclonal Anti-KRT78 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-KRT78 antibody is: synthetic peptide directed towards the middle region of Human KRT78. Synthetic peptide located within the following region: TQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEAEALYQTK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 45 kDa
Gene Name keratin 78
Database Link
Background This gene is a member of the type II keratin gene family and encodes a protein with an intermediate filament domain. Keratins are the major structural proteins in epithelial cells, forming a cytoplasmic network of 10 to 12 nm wide intermediate filaments and creating a scaffold that gives cells the ability to withstand mechanical and non-mechanical stresses. The genes of the type II keratin family are located as a gene cluster at 12p13.13. Four pseudogenes of this gene family have been identified.
Synonyms CK-78; K5B; K78; Kb40
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 92%; Horse: 92%; Sheep: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data
Write Your Own Review
You're reviewing:KRT78 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.