KRT78 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-KRT78 antibody is: synthetic peptide directed towards the middle region of Human KRT78. Synthetic peptide located within the following region: TQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEAEALYQTK |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 45 kDa |
Gene Name | keratin 78 |
Database Link | |
Background | This gene is a member of the type II keratin gene family and encodes a protein with an intermediate filament domain. Keratins are the major structural proteins in epithelial cells, forming a cytoplasmic network of 10 to 12 nm wide intermediate filaments and creating a scaffold that gives cells the ability to withstand mechanical and non-mechanical stresses. The genes of the type II keratin family are located as a gene cluster at 12p13.13. Four pseudogenes of this gene family have been identified. |
Synonyms | CK-78; K5B; K78; Kb40 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 92%; Horse: 92%; Sheep: 92%; Rabbit: 92%; Guinea pig: 92% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.