IQCN Rabbit Polyclonal Antibody

SKU
TA337389
Rabbit Polyclonal Anti-KIAA1683 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-KIAA1683 antibody is: synthetic peptide directed towards the N-terminal region of Human KIAA1683. Synthetic peptide located within the following region: LPDKMEKAPPQPQHEGLKSKEHLPQQPAEGKTASRRVPRLRAVVESQAFK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 147 kDa
Gene Name KIAA1683
Database Link
Background The function of this protein remains unknown.
Synonyms MGC131731
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Write Your Own Review
You're reviewing:IQCN Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.