VIRMA Rabbit Polyclonal Antibody

SKU TA337384

Rabbit Polyclonal Anti-KIAA1429 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KIAA1429 antibody is: synthetic peptide directed towards the C-terminal region of Human KIAA1429. Synthetic peptide located within the following region: FKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 128 kDa
• Gene Name: KIAA1429
• Database Link:
  NP_892121
  Q69YN4
• Background: KIAA1429 may be involved in mRNA splicing regulation.
• Synonyms: fSAP121; MSTP054
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data