KDM4E Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "KDM4E"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-KDM4E antibody is: synthetic peptide directed towards the N-terminal region of Human KDM4E. Synthetic peptide located within the following region: YDDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 56 kDa |
Gene Name | lysine demethylase 4E |
Database Link | |
Background | KDM4E is a histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. |
Synonyms | JMJD2E; KDM4DL |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Dog: 83%; Pig: 83%; Horse: 83%; Bovine: 83%; Guinea pig: 83%; Zebrafish: 79%; Rabbit: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.