KDM4E Rabbit Polyclonal Antibody

SKU TA337374

Rabbit Polyclonal Anti-KDM4E Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KDM4E antibody is: synthetic peptide directed towards the N-terminal region of Human KDM4E. Synthetic peptide located within the following region: YDDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: lysine demethylase 4E
• Database Link:
  NP_001155102
  B2RXH2
• Background: KDM4E is a histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code.
• Synonyms: JMJD2E; KDM4DL
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Dog: 83%; Pig: 83%; Horse: 83%; Bovine: 83%; Guinea pig: 83%; Zebrafish: 79%; Rabbit: 77%

Reference Data