KDM4E Rabbit Polyclonal Antibody

CAT#: TA337374

Rabbit Polyclonal Anti-KDM4E Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "KDM4E"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-KDM4E antibody is: synthetic peptide directed towards the N-terminal region of Human KDM4E. Synthetic peptide located within the following region: YDDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name lysine demethylase 4E
Background KDM4E is a histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code.
Synonyms JMJD2E; KDM4DL
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Dog: 83%; Pig: 83%; Horse: 83%; Bovine: 83%; Guinea pig: 83%; Zebrafish: 79%; Rabbit: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.