INTS2 Rabbit Polyclonal Antibody

CAT#: TA337357

Rabbit Polyclonal Anti-INTS2 Antibody

Product Images

Host: Rabbit; Target Name: INTS2; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-INTS2 antibody is: synthetic peptide directed towards the N-terminal region of Human INTS2. Synthetic peptide located within the following region: VCRGLIKNGERQDEESLGGRRRTDALRFLCKMNPSQALKVRGMVVEECHL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 134 kDa
• Gene Name: integrator complex subunit 2
• Database Link:
  NP_065799
  Entrez Gene 57508 Human
  UniProt ID Q9H0H0
• Background: INTS2 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1.
• Synonyms: INT2; KIAA1287
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%