INO80C Rabbit Polyclonal Antibody

SKU TA337356

Rabbit Polyclonal Anti-INO80C Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-INO80C antibody is: synthetic peptide directed towards the N-terminal region of Human INO80C. Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 21 kDa
• Gene Name: INO80 complex subunit C
• Database Link:
  NP_919257
  Q6PI98
• Background: INO80C is a proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
• Synonyms: C18orf37; hIes6; IES6
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data