GPR180 Rabbit Polyclonal Antibody

SKU TA337330

Rabbit Polyclonal Anti-GPR180 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPR180 antibody is: synthetic peptide directed towards the N-terminal region of Human GPR180. Synthetic peptide located within the following region: FQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQTWH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: G protein-coupled receptor 180
• Database Link:
  NP_851320
  Q86V85
• Background: This gene encodes a protein that is a member of the G protein-coupled receptor superfamily. This protein is produced predominantly in vascular smooth muscle cells and may play an important role in the regulation of vascular remodeling.
• Synonyms: ITR
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 92%; Dog: 79%; Horse: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane