GOLPH3L Rabbit Polyclonal Antibody

SKU TA337326

Rabbit Polyclonal Anti-GOLPH3L Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GOLPH3L antibody is: synthetic peptide directed towards the N-terminal region of Human GOLPH3L. Synthetic peptide located within the following region: EISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: golgi phosphoprotein 3 like
• Database Link:
  NP_060648
  Q9H4A5
• Background: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking.
• Synonyms: GPP34R
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%; Mouse: 79%

Reference Data