FGD5 Rabbit Polyclonal Antibody

SKU
TA337310
Rabbit Polyclonal Anti-FGD5 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-FGD5 antibody is: synthetic peptide directed towards the C-terminal region of Human FGD5. Synthetic peptide located within the following region: FVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 59 kDa
Gene Name FYVE, RhoGEF and PH domain containing 5
Database Link
Background FGD5 activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. It mediates VEGF-induced CDC42 activation. It may regulate proangiogenic action of VEGF in vascular endothelial cells, including network formation, directional movement and proliferation and may play a role in regulating the actin cytoskeleton and cell shape.
Synonyms ZFYVE23
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%
Reference Data
Write Your Own Review
You're reviewing:FGD5 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.