ZNF289 (ARFGAP2) Rabbit Polyclonal Antibody

SKU TA337266

Rabbit Polyclonal Anti-ARFGAP29 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF289 antibody: synthetic peptide directed towards the N terminal of human ZNF289. Synthetic peptide located within the following region: YREKIRQLGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: ADP ribosylation factor GTPase activating protein 2
• Database Link:
  NP_115765
  Q8N6H7
• Background: ZNF289 is a candidate transcription factor
• Synonyms: IRZ; NBLA10535; ZFP289; ZNF289
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Bovine: 86%

Reference Data

• Protein Pathways: Endocytosis