RNF135 Rabbit Polyclonal Antibody
USD 665.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RNF135 antibody: synthetic peptide directed towards the middle region of human RNF135. Synthetic peptide located within the following region: DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPAL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 48 kDa |
Gene Name | ring finger protein 135 |
Database Link | |
Background | The protein encoded by RNF135 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. |
Synonyms | L13; MMFD; REUL; Riplet |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Bovine: 92%; Pig: 91%; Guinea pig: 91%; Mouse: 86%; Rat: 83%; Horse: 77% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review