RNF135 Rabbit Polyclonal Antibody

SKU TA337265

Rabbit Polyclonal Anti-RNF135 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF135 antibody: synthetic peptide directed towards the middle region of human RNF135. Synthetic peptide located within the following region: DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPAL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: ring finger protein 135
• Database Link:
  NP_115698
  Q8IUD6
• Background: The protein encoded by RNF135 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis.
• Synonyms: L13; MMFD; REUL; Riplet
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Bovine: 92%; Pig: 91%; Guinea pig: 91%; Mouse: 86%; Rat: 83%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome