TRIM62 Rabbit Polyclonal Antibody

SKU TA337228

Rabbit Polyclonal Anti-TRIM62 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM62 antibody: synthetic peptide directed towards the N terminal of human TRIM62. Synthetic peptide located within the following region: RALLCFFCDEPALHEQHQVTGIDDAFDELQRELKDQLQALQDSEREHTEA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: tripartite motif containing 62
• Database Link:
  NP_060677
  Q9BVG3
• Background: TRIM62 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions. RING-type zinc finger was identified in a group of proteins with a wide range of functions such as viral replication, signal transduction, and development. But the function of TRIM62 remains unknown.
• Synonyms: DEAR1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 92%

Reference Data

• Protein Families: Druggable Genome