Glycoprotein 2 (GP2) Rabbit Polyclonal Antibody

CAT#: TA336152

Rabbit Polyclonal Anti-GP2 Antibody


 Product Datasheet for 'TA336152'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications IHC, WB
Recommend Dilution IHC, WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-GP2 Antibody: synthetic peptide directed towards the middle region of human GP2. Synthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 43 kDa
Gene Name glycoprotein 2
Background GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
Synonyms ZAP75
Note Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Pig: 79%; Bovine: 79%
Reference Data
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones