Glycoprotein 2 (GP2) Rabbit Polyclonal Antibody

SKU TA336152

Rabbit Polyclonal Anti-GP2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GP2 Antibody: synthetic peptide directed towards the middle region of human GP2. Synthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: glycoprotein 2
• Database Link:
  NP_001007242
  P55259
• Background: GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
• Synonyms: ZAP75
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Pig: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane