NIPA2 Rabbit Polyclonal Antibody

SKU TA336140

Rabbit Polyclonal Anti-NIPA2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NIPA2 Antibody: synthetic peptide directed towards the middle region of human NIPA2. Synthetic peptide located within the following region: VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: non imprinted in Prader-Willi/Angelman syndrome 2
• Database Link:
  NP_001008860
  Q8N8Q9
• Background: NIPA2 belongs to the NIPA family. It is a multi-pass membrane protein. The function of the NIPA2 protein remains unknown.
• Synonyms: MGC5466
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Bovine: 93%; Rat: 86%; Mouse: 86%; Zebrafish: 85%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane