NHLRC3 Rabbit Polyclonal Antibody

SKU TA336106

Rabbit Polyclonal Anti-RP11-50D16.3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RP11-50D16.3 Antibody: synthetic peptide directed towards the middle region of human RP11-50D16.3. Synthetic peptide located within the following region: LVQVLGTPGKKGTSLNPLQFDNPAELYVEDTGDIYIVDGDGGLNNRLIKL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: NHL repeat containing 3
• Database Link:
  NP_001012772
  Q5JS37
• Background: RP11-50D16.3 contains 4 NHL repeats. The function of the RP11-50D16.3 protein remains unknown.
• Synonyms: DKFZp313M1221; DKFZp686E1140
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 86%; Zebrafish: 75%

Reference Data

• Protein Families: Transmembrane