DGAT2L3 (AWAT1) Rabbit Polyclonal Antibody

CAT#: TA336101

Rabbit Polyclonal Anti-AWAT1 Antibody

Product Images

WB Suggested Anti-AWAT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AWAT1 Antibody: synthetic peptide directed towards the N terminal of human AWAT1. Synthetic peptide located within the following region: LLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: acyl-CoA wax alcohol acyltransferase 1
• Database Link:
  NP_001013597
  Entrez Gene 158833 Human
  UniProt ID Q58HT5
• Background: The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.
• Synonyms: DGA2; DGAT2L3
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Zebrafish: 92%; Bovine: 86%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane