DGAT2L3 (AWAT1) Rabbit Polyclonal Antibody

SKU TA336100

Rabbit Polyclonal Anti-AWAT1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AWAT1 Antibody: synthetic peptide directed towards the N terminal of human AWAT1. Synthetic peptide located within the following region: NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: acyl-CoA wax alcohol acyltransferase 1
• Database Link:
  NP_001013597
  Q58HT5
• Background: The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.
• Synonyms: DGA2; DGAT2L3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 92%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Pig: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transmembrane