CUTA Rabbit Polyclonal Antibody

SKU TA336092

Rabbit Polyclonal Anti-CUTA Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CUTA Antibody: synthetic peptide directed towards the middle region of human CUTA. Synthetic peptide located within the following region: AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: cutA divalent cation tolerance homolog (E. coli)
• Database Link:
  NP_001014840
  O60888
• Background: CUTA may forms part of a complex of membrane proteins attached to acetylcholinesterase (AChE).
• Synonyms: ACHAP; C6orf82
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane