AK6 Rabbit Polyclonal Antibody

SKU TA336079

Rabbit Polyclonal Anti-TAF9 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC, assay
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TAF9 Antibody: synthetic peptide directed towards the N terminal of human TAF9. Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: adenylate kinase 6
• Database Link:
  NP_001015891
  Q9Y3D8
• Background: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds to the basal transcription factor GTF2B as well as to several transcriptional activators such as p53 and VP16.
• Synonyms: AD-004; CGI-137; CINAP; CIP; hCINAP
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Rat: 90%; Horse: 86%; Mouse: 86%; Rabbit: 79%; Guinea pig: 79%

Reference Data