VMA21 Rabbit Polyclonal Antibody

CAT#: TA336068

Reviews ()
Write a review

Rabbit Polyclonal Anti-VMA21 Antibody



Get 29% off any Over-Expression Cell Lysate, a validated WB control, with any Ab purchase. Use code “OEL29“. View details.

USD 300.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-VMA21 Antibody: synthetic peptide directed towards the N terminal of human LOC203547. Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 11 kDa
Gene Name VMA21 vacuolar H+-ATPase homolog (S. cerevisiae)
Background The function remains unknown.
Synonyms MEAX; XMEA
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Pig: 92%; Bovine: 92%; Dog: 86%
Reference Data
Protein Families Transmembrane
Other products for "VMA21"
Frequently bought together (3)
Recombinant protein of human VMA21 vacuolar H+-ATPase homolog (S. cerevisiae) (VMA21)
    • 20 ug

USD 748.00


Transient overexpression lysate of VMA21 vacuolar H+-ATPase homolog (S. cerevisiae) (VMA21)
    • 100 ug

USD 360.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies