VMA21 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB, IHC |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-VMA21 Antibody: synthetic peptide directed towards the N terminal of human LOC203547. Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 11 kDa |
| Gene Name | VMA21 vacuolar H+-ATPase homolog (S. cerevisiae) |
| Database Link | |
| Background | The function remains unknown. |
| Synonyms | MEAX; XMEA |
| Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Pig: 92%; Bovine: 92%; Dog: 86% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
lncRNA ZFPM2-AS1 promotes proliferation via miR-18b-5p/VMA21 axis in lung adenocarcinoma
Xue, Tao, Yu et al
J. Cell. Biochem. (2019) 121 (1), 313-321 DOI: 10.1002/jcb.29176
Xue, Tao, Yu et al
J. Cell. Biochem. (2019) 121 (1), 313-321 DOI: 10.1002/jcb.29176
AI Summary: OriGene products, specifically the VMA21 antibody (TA336068) and GAPDH antibody (TA890003), were used in this study to detect protein expression levels in lung adenocarcinoma cells, supporting the investigation of the ZFPM2-AS1/miR-18b-5p/VMA21 regulatory axis.
Snippet: … Membranes were subsequently incubated with primary antibody against VMA21 (Origene;TA336068) or GAPDH (Origene;TA890003) according to the manufacturer's protocol;- PVDF membranes were then blocked with 5% solution of nonfat milk for 1 hour. Membranes were subsequently incubated with primary antibody against VMA21 (Origene
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
