VMA21 Rabbit Polyclonal Antibody
Rabbit Polyclonal Anti-VMA21 Antibody
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-VMA21 Antibody: synthetic peptide directed towards the N terminal of human LOC203547. Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 11 kDa |
Gene Name | VMA21 vacuolar H+-ATPase homolog (S. cerevisiae) |
Database Link | |
Background | The function remains unknown. |
Synonyms | MEAX; XMEA |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Pig: 92%; Bovine: 92%; Dog: 86% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Antibody Resources |
USD 748.00
USD 360.00
USD 169.00