LRRC24 Rabbit Polyclonal Antibody

SKU TA336058

Rabbit Polyclonal Anti-LRRC24 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LRRC24 Antibody: synthetic peptide directed towards the N terminal of human LRRC24. Synthetic peptide located within the following region: PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: leucine rich repeat containing 24
• Database Link:
  NP_001019849
  Q50LG9
• Background: LRRC24 contains 1 Ig-like C2-type (immunoglobulin-like) domain and 7 LRR (leucine-rich) repeats. It is a single-pass membrane protein. The function of the LRRC24 protein remains unknown.
• Synonyms: LRRC14OS
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Guinea pig: 92%; Dog: 85%; Bovine: 85%

Reference Data

• Protein Families: Transmembrane