ANO6 Rabbit Polyclonal Antibody

SKU TA336048

Rabbit Polyclonal Anti-Ano6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ano6 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 106 kDa
• Gene Name: anoctamin 6
• Database Link:
  NP_001020527
  Q4KMQ2
• Background: Ano6 may act as a calcium-activated chloride channel By similarity. It is essential for calcium-dependent exposure of phosphatidylserine on the surface of activated platelets, a process necessary to trigger the clotting system.
• Synonyms: BDPLT7; SCTS; TMEM16F
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 92%; Mouse: 92%; Guinea pig: 77%

Reference Data

• Protein Families: Transmembrane