CCDC90A (MCUR1) Rabbit Polyclonal Antibody

SKU
TA336038
Rabbit Polyclonal Anti-CCDC90A Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CCDC90A Antibody: synthetic peptide directed towards the middle region of human CCDC90A. Synthetic peptide located within the following region: ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 40 kDa
Gene Name mitochondrial calcium uniporter regulator 1
Database Link
Background Essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
Synonyms C6orf79; CCDC90A; FMP32
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Bovine: 79%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CCDC90A (MCUR1) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.