ACBD7 Rabbit Polyclonal Antibody

SKU TA335983

Rabbit Polyclonal Anti-ACBD7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ACBD7 Antibody: synthetic peptide directed towards the N terminal of human ACBD7. Synthetic peptide located within the following region: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 10 kDa
• Gene Name: acyl-CoA binding domain containing 7
• Database Link:
  NP_001034933
  Q8N6N7
• Background: The function of this protein remains unknown.
• Synonyms: bA455B2.2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Horse: 86%; Bovine: 86%; Pig: 85%; Rabbit: 85%; Guinea pig: 85%; Mouse: 79%

Reference Data