l Afadin (AFDN) Rabbit Polyclonal Antibody

SKU TA335978

Rabbit Polyclonal Anti-MLLT4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MLLT4 Antibody: synthetic peptide directed towards the N terminal of human MLLT4. Synthetic peptide located within the following region: GVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: myeloid/lymphoid or mixed-lineage leukemia; translocated to, 4
• Database Link:
  NP_001035089
  P55196
• Background: AF6 is a Ras target that regulates cell-cell adhesions downstream of Ras activation. It is fused with MLL in leukemias caused by t(6;11) translocations.
• Synonyms: AF6
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Yeast: 92%; Guinea pig: 92%; Zebrafish: 91%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Adherens junction, Leukocyte transendothelial migration, Tight junction