FAM55D (NXPE4) Rabbit Polyclonal Antibody

SKU TA335938

Rabbit Polyclonal Anti-Fam55d Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Fam55d Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NSDVERFSDFHGYTQYLALKDIFQDLNVGVIDAWDMTVAYGINNVHPPED
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 61 kDa
• Gene Name: neurexophilin and PC-esterase domain family member 4
• Database Link:
  NP_001071107
  Q6UWF7
• Background: The function of this protein remains unknown.
• Synonyms: C11orf33; FAM55D
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 85%; Mouse: 85%

Reference Data

• Protein Families: Secreted Protein, Transmembrane