Sidekick 1 (SDK1) Rabbit Polyclonal Antibody

SKU TA335931

Rabbit Polyclonal Anti-SDK1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SDK1 Antibody: synthetic peptide directed towards the middle region of human SDK1. Synthetic peptide located within the following region: AVNEAGYGEPSNPSTAVSAQVEAPFYEEWWFLLVMALSSLIVILLVVFAL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: sidekick cell adhesion molecule 1
• Database Link:
  NP_001073121
  Q7Z5N4
• Background: SDK1 is a cell adhesion protein that guides axonal terminals to specific synapses in developing neurons. Dysregulation of this protein may play an important role in podocyte dysfunction in HIV-associated nephropathy.
• Synonyms: 5330440E10; 6720466O15Rik; FLJ31425; sidekick 1; sidekick homolog 1 (chicken)
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Bovine: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane