ZAR1L Rabbit Polyclonal Antibody

SKU TA335895

Rabbit Polyclonal Anti-ZAR1L Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZAR1L Antibody is: synthetic peptide directed towards the C-terminal region of Human ZAR1L. Synthetic peptide located within the following region: EPGQLEESGEKDAPCPQETKSKQVPGDAASEPLRRPNFQFLEPKYGYFHC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: zygote arrest 1-like
• Database Link:
  NP_001130043
  A6NP61
• Background: This gene encodes a member of the ZAR1 family that is predominantly expressed in oocytes and early embryos. The protein may function as an RNA regulator in early embryos.
• Synonyms: Z3CXXC7; ZAR2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data