Motilin (MLN) Rabbit Polyclonal Antibody

SKU TA335832

Rabbit Polyclonal Anti-MLN Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MLN Antibody: synthetic peptide directed towards the middle region of human MLN. Synthetic peptide located within the following region: LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 3 kDa
• Gene Name: motilin
• Database Link:
  NP_002409
  P12872
• Background: This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as mo
• Synonyms: MGC138519
• Note: Immunogen Sequence Homology: Human: 100%; Sheep: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane