PSMC5 Rabbit Polyclonal Antibody

CAT#: TA335803

Rabbit Polyclonal Anti-PSMC5 Antibody

Product Images

Sample Type: 4. rat brain extract (80ug); Primary Antibody Dilution: 2 ug/ml; Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary Antibody Dilution: 1: 20, 000; Image Submitted by: Yuzhi Chen; University of Arkansas for Medical Science;

• 

  WB Suggested Anti-PSMC5 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

• 

  Sample Type: Human brain stem cells Primary Antibody Dilution: 1: 500; Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody: ilution: 1: 1000; Color/Signal Descriptions: PSMC5: Red DAPI: Blue; Gene Name: PSMC5; Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science

• 

  Amount and Sample Type: 500 ug mouse brain homogenate; Amount of IP Antibody: 6 ug; Primary Antibody: PSMC5; Primary Antibody Dilution: 1: 500; Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody Dilution: 1: 5000; Gene Name: PSMC5; Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science

Specifications

Product Data

• Applications: IHC, IP, WB
• Recommended Dilution: WB, IHC, IP
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PSMC5 Antibody: synthetic peptide directed towards the C terminal of human PSMC5. Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: proteasome 26S subunit, ATPase 5
• Database Link:
  NP_002796
  Entrez Gene 19184 MouseEntrez Gene 5705 Human
  UniProt ID P62195
• Background: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits.PSMC5 is one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptional regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha.
• Synonyms: p45; S8; SUG; SUG-1; SUG1; TBP10; TRIP1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Proteasome