Transcription factor Sp4 (SP4) Rabbit Polyclonal Antibody

CAT#: TA335786

Rabbit Polyclonal Anti-SP4 Antibody

Product Images

WB Suggested Anti-SP4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

• 

  Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SP4 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SP4 Antibody: synthetic peptide directed towards the middle region of human SP4. Synthetic peptide located within the following region: GGTALAIVTSGELDSSVTEVLGSPRIVTVAAISQDSNPATPNVSTNMEEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: Sp4 transcription factor
• Database Link:
  NP_003103
  Entrez Gene 6671 Human
  UniProt ID Q02446
• Background: SP4 belongs to the Sp1 C2H2-type zinc-finger protein family. It contains 3 C2H2-type zinc fingers. SP4 binds to GT and GC boxes promoters elements.It is a probable transcriptional activator.
• Synonyms: HF1B; SPR-1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors