TIMELESS Rabbit Polyclonal Antibody

SKU TA335761

Rabbit Polyclonal Anti-TIMELESS Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TIMELESS Antibody: synthetic peptide directed towards the N terminal of human TIMELESS. Synthetic peptide located within the following region: IGERDLIFHKGLHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 139 kDa
• Gene Name: timeless circadian clock
• Database Link:
  NP_003911
  Q9UNS1
• Background: The human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the DNA damage checkpoint response. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the DNA damage checkpoints that is in part mediated by the Timeless protein.
• Synonyms: hTIM; TIM; TIM1
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Dog: 85%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Sheep: 77%; Rabbit: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Transcription Factors