TIMELESS Rabbit Polyclonal Antibody

CAT#: TA335761

Reviews ()
Write a review

Rabbit Polyclonal Anti-TIMELESS Antibody



USD 475.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TIMELESS Antibody: synthetic peptide directed towards the N terminal of human TIMELESS. Synthetic peptide located within the following region: IGERDLIFHKGLHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 139 kDa
Gene Name timeless circadian clock
Background The human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the DNA damage checkpoint response. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the DNA damage checkpoints that is in part mediated by the Timeless protein.
Synonyms hTIM; TIM; TIM1
Note Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Dog: 85%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Sheep: 77%; Rabbit: 77%; Guinea pig: 77%
Reference Data
Protein Families Transcription Factors
Other products for "TIMELESS"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.