Cip4 (TRIP10) Rabbit Polyclonal Antibody

SKU
TA335756
Rabbit Polyclonal Anti-TRIP10 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TRIP10 Antibody: synthetic peptide directed towards the N terminal of human TRIP10. Synthetic peptide located within the following region: ENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 63 kDa
Gene Name thyroid hormone receptor interactor 10
Database Link
Background TRIP10 is in FNBP1 family of proteins.
Synonyms CIP4; HSTP; STOT; STP; TRIP-10
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Insulin signaling pathway
Write Your Own Review
You're reviewing:Cip4 (TRIP10) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.