ZMYM3 Rabbit Polyclonal Antibody

SKU TA335722

Rabbit Polyclonal Anti-ZMYM3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZMYM3 Antibody: synthetic peptide directed towards the N terminal of human ZMYM3. Synthetic peptide located within the following region: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 152 kDa
• Gene Name: zinc finger MYM-type containing 3
• Database Link:
  NP_005087
  Q14202
• Background: The function remains unknown. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
• Synonyms: DXS6673E; MYM; XFIM; ZNF198L2; ZNF261
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors