ST6GALNAC2 Rabbit Polyclonal Antibody

SKU TA335687

Rabbit Polyclonal Anti-ST6GALNAC2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ST6GALNAC2 Antibody: synthetic peptide directed towards the middle region of human ST6GALNAC2. Synthetic peptide located within the following region: VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 2
• Database Link:
  NP_006447
  Q9UJ37
• Background: ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting.ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting (Samyn-Petit et al., 2000 [PubMed 10742600]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-255 AC015802.21 33337-33591 256-1378 BT019972.1 1-1123 1379-2105 AC015802.21 53295-54021
• Synonyms: SAITL1; SIAT7; SIAT7B; SIATL1; ST6GalNAII; STHM
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 92%; Bovine: 91%; Dog: 85%

Reference Data

• Protein Families: Transmembrane