FAM32A Rabbit Polyclonal Antibody

SKU TA335635

Rabbit Polyclonal Anti-FAM32A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM32A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM32A. Synthetic peptide located within the following region: DKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKAS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 12 kDa
• Gene Name: family with sequence similarity 32 member A
• Database Link:
  NP_054796
  Q9Y421
• Background: Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. FAM32A may also increase cell sensitivity to apoptotic stimuli.
• Synonyms: OTAG-12; OTAG12
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 92%

Reference Data