WDR42A (DCAF8) Rabbit Polyclonal Antibody

SKU TA335581

Rabbit Polyclonal Anti-DCAF8 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DCAF8 Antibody is: synthetic peptide directed towards the C-terminal region of Human DCAF8. Synthetic peptide located within the following region: LPVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: DDB1 and CUL4 associated factor 8
• Database Link:
  NP_056541
  Q5TAQ9
• Background: This gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex. Multiple alternatively spliced transcript variants have been found for this gene.
• Synonyms: GAN2; H326; WDR42A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data