DC2L1 (DYNC2LI1) Rabbit Polyclonal Antibody

SKU TA335575

Rabbit Polyclonal Anti-DYNC2LI1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DYNC2LI1 Antibody is: synthetic peptide directed towards the C-terminal region of Human DYNC2LI1. Synthetic peptide located within the following region: EKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: dynein cytoplasmic 2 light intermediate chain 1
• Database Link:
  NP_057092
  Q8TCX1
• Background: DYNC2LI1 may function as a motor for intraflagellar retrograde transport and functions in cilia biogenesis.
• Synonyms: CGI-60; D2LIC; LIC3; SRTD15
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rat: 92%; Rabbit: 86%; Mouse: 85%; Pig: 79%; Guinea pig: 79%

Reference Data