ERGIC2 Rabbit Polyclonal Antibody

SKU TA335552

Rabbit Polyclonal Anti-Ergic2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ergic2 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ergic2. Synthetic peptide located within the following region: MRRLNRRKTLSLVKELDAFPKVPDSYVETSASGGTVSLIAFTTMALLTIM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: ERGIC and golgi 2
• Database Link:
  NP_057654
  Q96RQ1
• Background: Ergic2 play a possible role in transport between endoplasmic reticulum and Golgi.
• Synonyms: cd002; CDA14; Erv41; PTX1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 92%; Guinea pig: 92%

Reference Data