BTB domain containing 5 (KLHL28) Rabbit Polyclonal Antibody

SKU TA335540

Rabbit Polyclonal Anti-KLHL28 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-BTBD5 Antibody: synthetic peptide directed towards the middle region of human BTBD5. Synthetic peptide located within the following region: GVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPMTTTRSCFAAA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: kelch like family member 28
• Database Link:
  NP_060128
  Q9NXS3
• Background: BTBD5 is a transcription factor containing BTB (POZ) domain
• Synonyms: BTBD5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data