C14orf101 (TMEM260) Rabbit Polyclonal Antibody

SKU TA335535

Rabbit Polyclonal Anti-Tmem260 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-6720456H20Rik Antibody is: synthetic peptide directed towards the middle region of Mouse 6720456H20Rik. Synthetic peptide located within the following region: LFRLLKEKELTLSLLLRLTLAFSAGLLPYVYLPVSSYLSRARWTWGDQTT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: transmembrane protein 260
• Database Link:
  NP_060269
  Q9NX78
• Background: The function of this protein remains unknown.
• Synonyms: C14orf101
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Bovine: 79%; Yeast: 75%

Reference Data

• Protein Families: Transmembrane