EFHC1 Rabbit Polyclonal Antibody

CAT#: TA335523

Rabbit Polyclonal Anti-EFHC1 Antibody

Product Images

WB Suggested Anti-EFHC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EFHC1 Antibody: synthetic peptide directed towards the N terminal of human EFHC1. Synthetic peptide located within the following region: SYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: EF-hand domain containing 1
• Database Link:
  NP_060570
  Entrez Gene 114327 Human
  UniProt ID Q5JVL4
• Background: This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy. Alternatively spliced transcript variants have been described.
• Synonyms: dJ304B14.2; EJM1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rat: 79%