DSCC1 Rabbit Polyclonal Antibody

CAT#: TA335474

Rabbit Polyclonal Anti-DSCC1 Antibody

Product Images

Host: Rabbit; Target Name: DSCC1; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DSCC1 Antibody is: synthetic peptide directed towards the middle region of Human DSCC1. Synthetic peptide located within the following region: MENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: DNA replication and sister chromatid cohesion 1
• Database Link:
  NP_076999
  Entrez Gene 79075 Human
  UniProt ID Q9BVC3
• Background: CHTF18, CHTF8, and DSCC1 are components of an alternative replication factor C (RFC) complex that loads PCNA onto DNA during S phase of the cell cycle.
• Synonyms: DCC1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 90%; Horse: 86%; Bovine: 86%; Mouse: 85%